Iright
BRAND / VENDOR: Proteintech

Proteintech, 25597-1-AP, SLC10A5 Polyclonal antibody

CATALOG NUMBER: 25597-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC10A5 (25597-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A5 in IHC, ELISA applications with reactivity to human, mouse samples 25597-1-AP targets SLC10A5 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Solute Carrier Family 10 Member 5 (SLC10A5) is a member of SLC10, comprising transporters of bile acids, steroidal hormones, and other substrates. SLC10A5 is involved in the uptake of bile acid, and its deficiency causes hypercholanemia(PMID: 38986003). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22339 Product name: Recombinant human SLC10A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-141 aa of BC136625 Sequence: ARMSSLSFLNIEKTEILFFTKTEETILVSSSYENKRPNSSHLFVKIEDPKILQMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDR Predict reactive species Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 5 Calculated Molecular Weight: 438 aa, 49 kDa GenBank Accession Number: BC136625 Gene Symbol: SLC10A5 Gene ID (NCBI): 347051 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5PT55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924