Iright
BRAND / VENDOR: Proteintech

Proteintech, 25605-1-AP, IQUB Polyclonal antibody

CATALOG NUMBER: 25605-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IQUB (25605-1-AP) by Proteintech is a Polyclonal antibody targeting IQUB in IHC, IP, ELISA applications with reactivity to human, mouse samples 25605-1-AP targets IQUB in IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse spleen tissue, mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IQUB (IQ motif and ubiquitin domain containing) was discovered in 2002,4 which was located on chromosome 7q31.32 and its encoded protein mainly contained 2 domains, ubiquitin-like domain and IQ domain. IQUB had apparently higher expression in breast cancer than that in normal tissues, suggesting that it may act an important role in the occurrence and development of breast cancer (PMID: 29968965). IQUB is a critical RS1 adaptor in mouse sperm flagella, and is critical for sperm motility and fertilization (PMID: 36417862). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19507 Product name: Recombinant human IQUB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC128181 Sequence: MSNQQEKYEAQNIVNSTEESDDAFDTVTIPVPSEEPQESDQTEEHESGIEQFSESHAIHVEEQSDQSFSSLEPDNEQLMEEVISPRQVSYTPQHHEKQYAMQRPNDDSLAFLDKIKSVKESLQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVTVQTGLDQYQQVPVEIVKSDFHKPFLGGFRHKVTGVEYHNAGTQTVPKRIPERLSIFCRDTQTVFQKKNLQQTTNTTSTQMTNIGVYVSNMTDKLVTPGKYFSAAEYHAQRLKAVIVIQTYYR Predict reactive species Full Name: IQ motif and ubiquitin domain containing Calculated Molecular Weight: 791 aa, 93 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC128181 Gene Symbol: IQUB Gene ID (NCBI): 154865 RRID: AB_3085807 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NA54 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924