Proteintech, 25613-1-AP, SMPD3 Polyclonal antibody

Size: 20ul / 150ul The SMPD3 (25613-1-AP) by Proteintech is a Polyclonal antibody targeting SMPD3 in WB, ELISA applications with reactivity to human samples 25613-1-AP targets SMPD3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SMPD3 (sphingomyelin phosphodiesterase 3), also called neutral sphingomyelinase-2 (nSMase2), is a Golgi-enriched, membrane-bound Zn²⁺-dependent hydrolase that converts sphingomyelin into ceramide and phosphocholine. Ceramide functions as a bioactive lipid second messenger that integrates cellular stress, apoptosis, autophagy and differentiation signals. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22487 Product name: Recombinant human SMPD3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 540-655 aa of BC112238 Sequence: PGEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA Predict reactive species Full Name: sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II) Calculated Molecular Weight: 655 aa, 71 kDa Observed Molecular Weight: 70-71 kDa GenBank Accession Number: BC112238 Gene Symbol: SMPD3 Gene ID (NCBI): 55512 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY59 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.