Proteintech, 25615-1-AP, MBOAT1 Polyclonal antibody

Size: 20ul / 150ul The MBOAT1 (25615-1-AP) by Proteintech is a Polyclonal antibody targeting MBOAT1 in WB, ELISA applications with reactivity to human samples 25615-1-AP targets MBOAT1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MBOAT1 (membrane bound O-acyltransferase domain containing 1), also known as LPLAT or LPSAT. It is expected to be located in membrane and widely expressed in colon, small intestine. MBOAT1 belongs to the membrane-bound O- acetyltransferase superfamily. Its encoded transmembrane protein is an enzyme that transfers organic compounds, preferably oleoyl-CoA, to the hydroxyl group of protein target in the membrane. The translocation that destroys the gene may be related to short finger toe syndrome. At the same time, it may also play a role in neurite growth during neuronal differentiation (PMID: 18772128). Studies have determined that phospholipid modifying enzymes MBOAT1 and MBOAT2 are iron sag inhibitors. MBOAT1/2 can inhibit iron sag by reshaping the phospholipid profile of cells, and their iron sag monitoring function is independent of GPX4 or FSP1. MBOAT1 and MBOAT2 are up-regulated by sex hormone receptors, namely estrogen receptor (ER) and androgen receptor (AR), respectively (PMID: 37267948). The calculated molecular weight of MBOAT1 is 57 kDa. This antibody can recognize the 40 kDa isoform of MBOAT1. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22470 Product name: Recombinant human MBOAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 192-286 aa of BC150652 Sequence: FMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLY Predict reactive species Full Name: membrane bound O-acyltransferase domain containing 1 Calculated Molecular Weight: 495 aa, 57 kDa Observed Molecular Weight: 45-57 kDa GenBank Accession Number: BC150652 Gene Symbol: MBOAT1 Gene ID (NCBI): 154141 RRID: AB_3085808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZNC8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.