Iright
BRAND / VENDOR: Proteintech

Proteintech, 25626-1-AP, SLC52A3 Polyclonal antibody

CATALOG NUMBER: 25626-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC52A3 (25626-1-AP) by Proteintech is a Polyclonal antibody targeting SLC52A3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25626-1-AP targets SLC52A3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human stomach cancer tissue, human oesophagus cancer tissue, human small intestine tissue, human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22315 Product name: Recombinant human C20orf54 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 130-303 aa of BC009750 Sequence: MSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPVPTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRLREENDLGPAGMVDSSQGQGYLEEKAAPCCPAHLAFV Predict reactive species Full Name: Solute carrier family 52, riboflavin transporter, member 3 Calculated Molecular Weight: 469 aa, 51 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC009750 Gene Symbol: SLC52A3 Gene ID (NCBI): 113278 RRID: AB_2880167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924