Proteintech, 25630-1-AP, C9orf61 Polyclonal antibody

Size: 20ul / 150ul The C9orf61 (25630-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf61 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25630-1-AP targets C9orf61 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue Positive IHC detected in: human heart tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information C9orf61, also named as FAM189A2 and X123, is promoinently expressed in muscle. It has three isoforms with MW 45-50 kDa, 32-35 kDa and 27 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22242 Product name: Recombinant human C9orf61 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 288-450 aa of BC113685 Sequence: PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFLEQIMAPLQPSTSRAHKLPSRRQPGLLHLQSCGDLHTFTPAGRPRAERRPRRVEAERPHSLIGVIRETVL Predict reactive species Full Name: chromosome 9 open reading frame 61 Calculated Molecular Weight: 450 aa, 50 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC113685 Gene Symbol: C9orf61 Gene ID (NCBI): 9413 RRID: AB_2880170 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.