Iright
BRAND / VENDOR: Proteintech

Proteintech, 25634-1-AP, TMEM81 Polyclonal antibody

CATALOG NUMBER: 25634-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM81 (25634-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM81 in WB, ELISA applications with reactivity to human, mouse samples 25634-1-AP targets TMEM81 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information TMEM81 (also named HC3107 or KVLA2788) may be an integral component of the membrane. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22367 Product name: Recombinant human TMEM81 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 55-228 aa of BC061592 Sequence: LGYKEETVCEVGPDGVRRKCQTRRLECLTNWICGMLHFTILIGKEFELSCLSSDILEFGQEAFRFTWRLARGVISTDDEVFKPFQANSHFVKFKYAQEYDSGTYRCDVQLVKNLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASAL Predict reactive species Full Name: transmembrane protein 81 Calculated Molecular Weight: 255 aa, 28 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC061592 Gene Symbol: TMEM81 Gene ID (NCBI): 388730 RRID: AB_3669489 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P7N7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924