Iright
BRAND / VENDOR: Proteintech

Proteintech, 25643-1-AP, VNN2 Polyclonal antibody

CATALOG NUMBER: 25643-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VNN2 (25643-1-AP) by Proteintech is a Polyclonal antibody targeting VNN2 in WB, IF/ICC, ELISA applications with reactivity to human samples 25643-1-AP targets VNN2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22345 Product name: Recombinant human VNN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 448-520 aa of BC126145 Sequence: EIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML Predict reactive species Full Name: vanin 2 Calculated Molecular Weight: 520 aa, 59 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC126145 Gene Symbol: VNN2 Gene ID (NCBI): 8875 RRID: AB_2880173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95498 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924