Proteintech, 25658-1-AP, DENND1A Polyclonal antibody

Size: 20ul / 150ul The DENND1A (25658-1-AP) by Proteintech is a Polyclonal antibody targeting DENND1A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 25658-1-AP targets DENND1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, A2780 cells, K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DENND1A (DENN/MADD domain containing 1A), also known as Connecdenn,FAM31A or KIAA1608, is a 1,009 amino acid peripheral membrane protein. Recent studies has found DENND1A is strongly associated with PCOS (Polycystic ovary syndrome). DENND1A has several isoforms.This antibody(25658-1-AP) can recognize all the isoforms at 112 kDa, 52-64 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22547 Product name: Recombinant human DENND1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 451-559 aa of BC039703 Sequence: QKDIAENGCAPTPEEQLPKTAPSPLVEAKDPKLREDRRPITVHFGQVRPPRPHVVKRPKSNIAVEGRRTSVPSPEQNTIATPATLHILQKSITHFAAKFPTRGWTSSSH Predict reactive species Full Name: DENN/MADD domain containing 1A Calculated Molecular Weight: 1009 aa, 111 kDa Observed Molecular Weight: 111 kDa, 64 kDa GenBank Accession Number: BC039703 Gene Symbol: DENND1A Gene ID (NCBI): 57706 RRID: AB_2880180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TEH3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.