Product Description
Size: 20ul / 150ul
The GGA1 (25674-1-AP) by Proteintech is a Polyclonal antibody targeting GGA1 in WB, IF/ICC, ELISA applications with reactivity to human, rat, mouse samples
25674-1-AP targets GGA1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat, mouse samples.
Tested Applications
Positive WB detected in: HEK-293 cells, mouse brain tissue, rat brain tissue, HeLa cells, SH-SY5Y cells
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:16000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Specification
Tested Reactivity: human, rat, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22614 Product name: Recombinant human GGA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 276-395 aa of BC044629 Sequence: ALGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPE Predict reactive species
Full Name: golgi associated, gamma adaptin ear containing, ARF binding protein 1
Observed Molecular Weight: 70-72 kDa
GenBank Accession Number: BC044629
Gene Symbol: GGA1
Gene ID (NCBI): 26088
RRID: AB_2880188
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UJY5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924