Proteintech, 25682-1-AP, CD63 Polyclonal antibody

Size: 20ul / 150ul The CD63 (25682-1-AP) by Proteintech is a Polyclonal antibody targeting CD63 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 25682-1-AP targets CD63 in WB, IHC, IF/ICC, IF-P, IP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human urine exosomes tissue, A375 cells, human serum exosomes, THP-1 cells, human peripheral blood platelets Positive IHC detected in: human malignant melanoma tissue, human lymphoma tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human malignant melanoma tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:40000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein that is translocated to plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it as a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Specification Tested Reactivity: human Cited Reactivity: human, pig, rabbit, monkey, hamster, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19690 Product name: Recombinant human CD63 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 104-209 aa of BC002349 Sequence: GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA Predict reactive species Full Name: CD63 molecule Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 30-60 kDa GenBank Accession Number: BC002349 Gene Symbol: CD63 Gene ID (NCBI): 967 RRID: AB_2783831 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08962 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.