Product Description
Size: 20ul / 150ul
The RNFT2 (25685-1-AP) by Proteintech is a Polyclonal antibody targeting RNFT2 in WB, ELISA applications with reactivity to human samples
25685-1-AP targets RNFT2 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HepG2 cells, SMMC-7721 cells
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22313 Product name: Recombinant human RNFT2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 139-231 aa of BC011878 Sequence: LYVLYTFSSEIAPQHSNLGDRVSETLSKKKKKERREGGRKEGRKERKKAQLWPRCGYPLVSCLYVFLLFLFCHLPHLSLRPVSSSCGHCHPLW Predict reactive species
Full Name: ring finger protein, transmembrane 2
Calculated Molecular Weight: 444 aa, 49 kDa
Observed Molecular Weight: 49-59 kDa
GenBank Accession Number: BC011878
Gene Symbol: RNFT2
Gene ID (NCBI): 84900
RRID: AB_2880194
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96EX2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924