Proteintech, 25699-1-AP, BDNF Polyclonal antibody

Size: 20ul / 150ul The BDNF (25699-1-AP) by Proteintech is a Polyclonal antibody targeting BDNF in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 25699-1-AP targets BDNF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information 1) What is BDNF?BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.2) FAQs for BDNFA) I can detect more than one band in my samplesBDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit, macaque Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22489 Product name: Recombinant human BDNF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-179 aa of BC029795 Sequence: SDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ Predict reactive species Full Name: brain-derived neurotrophic factor Calculated Molecular Weight: 247 aa, 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC029795 Gene Symbol: BDNF Gene ID (NCBI): 627 RRID: AB_3669493 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23560 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. FAQ A) I can detect more than one band in my samplesBDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678). ProtocolsProduct Specific ProtocolsIF protocol for BDNF antibody 25699-1-APDownload protocolIHC protocol for BDNF antibody 25699-1-APDownload protocolWB protocol for BDNF antibody 25699-1-APDownload protocolStandard ProtocolsClick here to view our Standard Protocols ProtocolsProduct Specific ProtocolsIF protocol for BDNF antibody 25699-1-APDownload protocolIHC protocol for BDNF antibody 25699-1-APDownload protocolWB protocol for BDNF antibody 25699-1-APDownload protocolStandard ProtocolsClick here to view our Standard Protocols