Proteintech, 25702-1-AP, CDKL1 Polyclonal antibody

Size: 20ul / 150ul The CDKL1 (25702-1-AP) by Proteintech is a Polyclonal antibody targeting CDKL1 in WB, ELISA applications with reactivity to human samples 25702-1-AP targets CDKL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, COLO 205 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22541 Product name: Recombinant human CDKL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 255-358 aa of BC104977 Sequence: PNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI Predict reactive species Full Name: cyclin-dependent kinase-like 1 (CDC2-related kinase) Calculated Molecular Weight: 358 aa, 42 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC104977 Gene Symbol: CDKL1 Gene ID (NCBI): 8814 RRID: AB_3669494 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00532 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.