Proteintech, 25705-1-AP, ARMCX3 Polyclonal antibody

Size: 20ul / 150ul The ARMCX3 (25705-1-AP) by Proteintech is a Polyclonal antibody targeting ARMCX3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 25705-1-AP targets ARMCX3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: fetal human brain Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ARMCX3, also named as Armadillo repeat-containing X-linked protein 3, is a 379 amino acid protein, which contains 3 ARM repeats. ARMCX3 is a single pass membrane protein belonging to the armadillo repeat family of proteins. ARMCX3 is believed to play a role in embryonic development and tissue maintenance and may also function as a tumor suppressor. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22501 Product name: Recombinant human ARMCX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-145 aa of BC005194 Sequence: MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIA Predict reactive species Full Name: armadillo repeat containing, X-linked 3 Calculated Molecular Weight: 379 aa, 43 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC005194 Gene Symbol: ARMCX3 Gene ID (NCBI): 51566 RRID: AB_2880201 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UH62 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.