Proteintech, 25711-1-AP, CHCHD5 Polyclonal antibody

Size: 20ul / 150ul The CHCHD5 (25711-1-AP) by Proteintech is a Polyclonal antibody targeting CHCHD5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 25711-1-AP targets CHCHD5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, HepG2 cells, MCF-7 cells Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22503 Product name: Recombinant human CHCHD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC004498 Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS Predict reactive species Full Name: coiled-coil-helix-coiled-coil-helix domain containing 5 Calculated Molecular Weight: 110 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC004498 Gene Symbol: CHCHD5 Gene ID (NCBI): 84269 RRID: AB_3085818 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.