Iright
BRAND / VENDOR: Proteintech

Proteintech, 25727-1-AP, ATP1A3 Polyclonal antibody

CATALOG NUMBER: 25727-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP1A3 (25727-1-AP) by Proteintech is a Polyclonal antibody targeting ATP1A3 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 25727-1-AP targets ATP1A3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ATP1A3 participates in the catalyticing hydrolysis of ATP and the exchanging of sodium and potassium ions across plasma membrane. The catalyticing activity mode is ATP + H2O + Na+(In) + K+(Out) = ADP + phosphate + Na+(Out) + K+(In). It has been published that the neurologic disorders rapid-onset dystonia-parkionsonism (RDP), alternating hemiplegia of childhood (ACH) and CAPOS syndrome (cerebellar ataxia, areflexia, pes cavus, optic atrophy and sensorineural hearing loss) are all related with the mutation of ATP1A3. There are other reports suggest that early life epilepsy and episodic apnea revealing are potentially associated with the mutation of ATP1A3 as a result of impairment of Na/K homeostasis. This antibody is generated against the C-terminal region (665-1013aa) of ATP1A3 and detects the band around 100-113 kDa in SDS-PAGE.(PMID: 30097153, 20301294, 29922587) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22842 Product name: Recombinant human ATP1A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC015566 Sequence: MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARD Predict reactive species Full Name: ATPase, Na+/K+ transporting, alpha 3 polypeptide Calculated Molecular Weight: 1013 aa, 112 kDa Observed Molecular Weight: 110-113 kDa GenBank Accession Number: BC015566 Gene Symbol: ATP1A3 Gene ID (NCBI): 478 RRID: AB_3085820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13637 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924