Proteintech, 25728-1-AP, HBG1 Polyclonal antibody

Size: 20ul / 150ul The HBG1 (25728-1-AP) by Proteintech is a Polyclonal antibody targeting HBG1 in WB, IP, ELISA applications with reactivity to human samples 25728-1-AP targets HBG1 in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, human placenta tissue Positive IP detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22776 Product name: Recombinant human HBG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC010913 Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIH Predict reactive species Full Name: hemoglobin, gamma A Calculated Molecular Weight: 147 aa, 16 kDa Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC010913 Gene Symbol: HBG1 Gene ID (NCBI): 3047 RRID: AB_2880212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P69891 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.