Iright
BRAND / VENDOR: Proteintech

Proteintech, 25737-1-AP, ANKRD13B Polyclonal antibody

CATALOG NUMBER: 25737-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANKRD13B (25737-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD13B in WB, IHC, ELISA applications with reactivity to human, mouse samples 25737-1-AP targets ANKRD13B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse small intestine tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ANKRD13B (ankyrin repeat domain 13B) is an ubiquitin-binding protein belongs to the Ankrd 13 family. It specifically recognizes and binds 'Lys-63'-linked ubiquitin, and positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane (PMID: 22298428). This antibody specifically recognises the 70 kDa protein. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22732 Product name: Recombinant human ANKRD13B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 433-493 aa of BC032554 Sequence: FGNLNGCDEPVPSVRGSPSSETPSPGSDSSSVSSSSSTTSCRGCEISPALFEAPRGYSMMG Predict reactive species Full Name: ankyrin repeat domain 13B Calculated Molecular Weight: 626 aa, 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC032554 Gene Symbol: ANKRD13B Gene ID (NCBI): 124930 RRID: AB_2880217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YJ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924