Product Description
Size: 20ul / 150ul
The OATP5A1/SLCO5A1 (25744-1-AP) by Proteintech is a Polyclonal antibody targeting OATP5A1/SLCO5A1 in WB, ELISA applications with reactivity to human, mouse, rat samples
25744-1-AP targets OATP5A1/SLCO5A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: DU 145 cells, mouse brain tissue, PC-3 cells, rat brain tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22620 Product name: Recombinant human SLCO5A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-128 aa of BC137424 Sequence: MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR Predict reactive species
Full Name: solute carrier organic anion transporter family, member 5A1
Observed Molecular Weight: 110-12 kDa
GenBank Accession Number: BC137424
Gene Symbol: SLCO5A1
Gene ID (NCBI): 81796
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9H2Y9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924