Iright
BRAND / VENDOR: Proteintech

Proteintech, 25749-1-AP, EPHA2 Polyclonal antibody

CATALOG NUMBER: 25749-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPHA2 (25749-1-AP) by Proteintech is a Polyclonal antibody targeting EPHA2 in WB, ELISA applications with reactivity to human samples 25749-1-AP targets EPHA2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information EPHA2 (Ephrin type-A receptor 2) belongs to the receptor tyrosine kinase (RTK) family, with 16 known receptors and 9 known membrane-bound ligands in all species. Based on the extracellular domain sequence homology, structure, and binding affinity, Eph receptors and their ephrin ligands can be divided into A and B subtypes (PMID: 33962882). EPHA2 contains a conserved N-terminal ligand-bound extracellular domain, a transmembrane domain, and a conserved tyrosine kinase domain (PMID: 8070404). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22661 Product name: Recombinant human EPHA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-535 aa of BC037166 Sequence: DACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNL Predict reactive species Full Name: EPH receptor A2 Calculated Molecular Weight: 976 aa, 108 kDa Observed Molecular Weight: 125-130 kDa GenBank Accession Number: BC037166 Gene Symbol: EPHA2 Gene ID (NCBI): 1969 RRID: AB_3669497 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29317 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924