Proteintech, 25757-1-AP, C9orf72 Polyclonal antibody

Size: 20ul / 150ul The C9orf72 (25757-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf72 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25757-1-AP targets C9orf72 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells, SH-SY5Y cells Positive IHC detected in: human appendicitis tissue, human ovary tumor tissue, human testis tissue, mouse kidney tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:300-1:1500 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. This antibody detects the N-terminal of C9orf72. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22723 Product name: Recombinant human C9orf72 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-221 aa of BC068445 Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEIDIADTVLNDDDIGDSCHEGFLL Predict reactive species Full Name: chromosome 9 open reading frame 72 Calculated Molecular Weight: 481 aa, 54 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC068445 Gene Symbol: C9orf72 Gene ID (NCBI): 203228 RRID: AB_2784548 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LT7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.