Proteintech, 25776-1-AP, BCAS1 Polyclonal antibody

Size: 20ul / 150ul The BCAS1 (25776-1-AP) by Proteintech is a Polyclonal antibody targeting BCAS1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25776-1-AP targets BCAS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, MCF-7 cells, NIH/3T3 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22760 Product name: Recombinant human BCAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC126348 Sequence: MGNQMSVPQRVEDQENEPEAETYKDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNLGKEAKPEAPAAKSRFFLMLSRPVPGRTGDQAADSSLGSVKLDVSSNKAPANKDPSESWTLPVAAGPGQDTDKTPGHAPAQDKALSAARDPTLLPPETGGAGGEAPSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQAAAIAENNNSIMS Predict reactive species Full Name: breast carcinoma amplified sequence 1 Calculated Molecular Weight: 584 aa, 62 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC126348 Gene Symbol: BCAS1 Gene ID (NCBI): 8537 RRID: AB_2880235 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75363 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.