Iright
BRAND / VENDOR: Proteintech

Proteintech, 25780-1-AP, MTCL1 Polyclonal antibody

CATALOG NUMBER: 25780-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTCL1 (25780-1-AP) by Proteintech is a Polyclonal antibody targeting MTCL1 in WB, IP, ELISA applications with reactivity to human, canine samples 25780-1-AP targets MTCL1 in WB, IP, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, MDCK cells Positive IP detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Microtubule cross‐linking factor 1 (MTCL1) is a MT‐regulating protein that plays essential roles in accumulating the non-centrosomal MTs into the apicobasal MT bundles. MTCL1, identified as a binding protein of the cell polarity‐regulating kinase, PAR‐1b/MARK2, is recruited to the Golgi membranes through interactions with CLASPs and AKAP450/CG-NAP, and promotes microtubule growth from the Golgi membrane. Western blot analysis detected MTCL1 at an apparent molecular mass of 250 kDa as indicated in the literature (PMID: 23902687, 28283581). Specification Tested Reactivity: human, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22718 Product name: Recombinant human KIAA0802 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 775-976 aa of BC040542 Sequence: IDHSPVVQDPFQKGLRAGSRSRSAEPRPELGPGQETGTNSRGRSPSPIGVGSEMCREEGGEGTPVKQDLSAPPGYTLTENVARILNKKLLEHALKEERRQAAHGPPGLHSDSHSLGDTAEPGPMEELPCSALAPSLEPCFSRPERPANRRPPSRWAPHSPTASQPQSPGDPTSLEEHGGEEPPEEQPHRDASLHGLSQYNSL Predict reactive species Full Name: KIAA0802 Calculated Molecular Weight: 1905 aa, 209 kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: BC040542 Gene Symbol: MTCL1 Gene ID (NCBI): 23255 RRID: AB_3669499 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4B5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924