Proteintech, 25781-1-AP, UQCC2 Polyclonal antibody

Size: 20ul / 150ul The UQCC2 (25781-1-AP) by Proteintech is a Polyclonal antibody targeting UQCC2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 25781-1-AP targets UQCC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information UQCC2, also named as C6orf125, MNF1, Mitochondrial protein M19 and Breast cancer-associated protein SGA-81M, plays a role in the modulation of respiratory chain activities. It's a mitochondrial protein. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22710 Product name: Recombinant human C6orf125 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC006007 Sequence: MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA Predict reactive species Full Name: chromosome 6 open reading frame 125 Calculated Molecular Weight: 126 aa, 15 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC006007 Gene Symbol: UQCC2 Gene ID (NCBI): 84300 RRID: AB_2880237 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.