Proteintech, 25807-1-AP, ZC3H18 Polyclonal antibody

Size: 20ul / 150ul The ZC3H18 (25807-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3H18 in WB, IHC, ELISA applications with reactivity to human samples 25807-1-AP targets ZC3H18 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human tonsillitis tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ZC3H18, also named as NHN1, has two CCCH zinc finger domains. It is not essential in bloodstream forms, but in an in vitro model of differentiation. ZC3H18 recruites the TREX protein for SEP1-mediated mRNA export. The gene ZC3H18 has some isoforms with calculated MW 160 kDa and 84 kDa. With phospho modification, the MW of ZC3H18 is about 150 kDa in WB detection. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20481 Product name: Recombinant human ZC3H18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC050463 Sequence: MDVAESPERDPHSPEDEEQPQGLSDDDILRDSGSDQDLDGAGVRASDLEDEESAARGPSQEEEDNHSDEEDRASEPKSQDQDSEVNELSRGPTSSPCEEEGDEGEEDRTSDLRDEASSVTRELDEHELDYDEEVPEEPAPAVQEDEAEKAGAEDDEEKGEGTPREEGKAGVQSVGEKESLEAAKEKKKEDDDGEIDDGEIDDDDLEEGEVKDPSDRKVRPRPTCRFF Predict reactive species Full Name: zinc finger CCCH-type containing 18 Calculated Molecular Weight: 953 aa, 106 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC050463 Gene Symbol: ZC3H18 Gene ID (NCBI): 124245 RRID: AB_2721255 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86VM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.