Proteintech, 25815-1-AP, SMCO4 Polyclonal antibody

Size: 20ul / 150ul The SMCO4 (25815-1-AP) by Proteintech is a Polyclonal antibody targeting SMCO4 in WB, IHC, ELISA applications with reactivity to human samples 25815-1-AP targets SMCO4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Background Information SMCO4, also named as C11orf75 and FN5, is a Single-pass membrane and coiled-coil domain-containing protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22806 Product name: Recombinant human C11orf75 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-59 aa of BC031564 Sequence: MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE Predict reactive species Full Name: chromosome 11 open reading frame 75 Calculated Molecular Weight: 59 aa, 7 kDa Observed Molecular Weight: 7 kDa GenBank Accession Number: BC031564 Gene Symbol: SMCO4 Gene ID (NCBI): 56935 RRID: AB_2880249 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.