Proteintech, 25825-1-AP, VSX2 Polyclonal antibody

Size: 20ul / 150ul The VSX2 (25825-1-AP) by Proteintech is a Polyclonal antibody targeting VSX2 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse samples 25825-1-AP targets VSX2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse eye tissue Positive IHC detected in: human retinoblastoma tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Positive IF-Fro detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23035 Product name: Recombinant human VSX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC128153 Sequence: MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRK Predict reactive species Full Name: visual system homeobox 2 Calculated Molecular Weight: 361 aa, 39 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC128153 Gene Symbol: VSX2 Gene ID (NCBI): 338917 RRID: AB_2880257 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58304 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.