Iright
BRAND / VENDOR: Proteintech

Proteintech, 25832-1-AP, MIS18A Polyclonal antibody

CATALOG NUMBER: 25832-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C21orf45 (25832-1-AP) by Proteintech is a Polyclonal antibody targeting C21orf45 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25832-1-AP targets C21orf45 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information C21orf45, also named as MIS18A, C21orf46 and FASP1, is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. C21orf45 has dimer(~52 kDa) and heterodimer(~105 kDa) forms. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22922 Product name: Recombinant human C21orf45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC042917 Sequence: MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATCKS Predict reactive species Full Name: chromosome 21 open reading frame 45 Calculated Molecular Weight: 233 aa, 26 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC042917 Gene Symbol: C21orf45 Gene ID (NCBI): 54069 RRID: AB_2880259 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYP9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924