Proteintech, 25835-1-AP, DGCR8 N-terminal Polyclonal antibody

Size: 20ul / 150ul The DGCR8 N-terminal (25835-1-AP) by Proteintech is a Polyclonal antibody targeting DGCR8 N-terminal in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 25835-1-AP targets DGCR8 N-terminal in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells Positive IP detected in: A431 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information DGCR8 is a RNA-binding protein that assists the Rnase III enzyme Drosha in the processing of microRNAs (miRNAs), which regulate the expression of a large number of protein-coding genes[PMID: 22580560]. DGCR8, which contains two double-stranded RNA (dsRNA)-binding domains, may be an essential component of the primary miRNAs processing complex, along with Drosha, promoting the processing of primary microRNA to precursor microRNA. It is ubiquitous expressed in human and mouse tissues, and is deleted in DiGeorge syndrome[22323604]. The calculated molecular weight of DGCR8 is 82-86 kDa, but the post-modified DGCR8 is about 120 kDa. Specification Tested Reactivity: human Cited Reactivity: mouse, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22988 Product name: Recombinant human DGCR8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC078147 Sequence: METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPL Predict reactive species Full Name: DiGeorge syndrome critical region gene 8 Calculated Molecular Weight: 773 aa, 86 kDa Observed Molecular Weight: 88-100 kDa GenBank Accession Number: BC078147 Gene Symbol: DGCR8 Gene ID (NCBI): 54487 RRID: AB_2880262 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WYQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.