Iright
BRAND / VENDOR: Proteintech

Proteintech, 25845-1-AP, SUDS3 Polyclonal antibody

CATALOG NUMBER: 25845-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SUDS3 (25845-1-AP) by Proteintech is a Polyclonal antibody targeting SUDS3 in WB, ELISA applications with reactivity to human samples 25845-1-AP targets SUDS3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SUDS3 (Sin3 histone deacetylase corepressor complex component SDS3), also known as SAP45 andSDS3, is a component of the Sin3 histone deacetylase corepressor complex. In this complex SDS3 interacts with SIN3A to regulate gene expression via chromatin modification. SUDS3 represses transcription and augments histone deacetylase activity of HDAC1. It may have a potential role in tumor suppressor pathways through regulation of apoptosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22961 Product name: Recombinant human SUDS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC112000 Sequence: ELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA Predict reactive species Full Name: suppressor of defective silencing 3 homolog (S. cerevisiae) Calculated Molecular Weight: 328 aa, 38 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC112000 Gene Symbol: SUDS3 Gene ID (NCBI): 64426 RRID: AB_2880265 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7L9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924