Iright
BRAND / VENDOR: Proteintech

Proteintech, 25887-1-AP, Chk1 Polyclonal antibody

CATALOG NUMBER: 25887-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Chk1 (25887-1-AP) by Proteintech is a Polyclonal antibody targeting Chk1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 25887-1-AP targets Chk1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, K-562 cells, MCF-7 cells Positive IP detected in: HEK-293T cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293T cells Positive FC (Intra) detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information CHEK1(Checkpoint kinase-1) is also named as CHK1 and belongs to the protein kinase superfamily. It is implicated in a circuit in which it activates checkpoints, DNA repair and proliferating cell nuclear antigen and FANCD2 monoubiquitinylation(PMID:21389083). CHEK1 protects vertebrate cells against spontaneous chromosome missegregation and is required to sustain anaphase delay when spindle function is disrupted by taxol(PMID:17276342). It has 3 isoforms produced by alternative splicing with the molecular mass of 54 kDa, 44 kDa and 50 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22993 Product name: Recombinant human CHK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 262-476 aa of BC004202 Sequence: DRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT Predict reactive species Full Name: CHK1 checkpoint homolog (S. pombe) Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC004202 Gene Symbol: Chk1 Gene ID (NCBI): 1111 RRID: AB_2880283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14757 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924