Proteintech, 25889-1-AP, LIPF Polyclonal antibody

Size: 20ul / 150ul The LIPF (25889-1-AP) by Proteintech is a Polyclonal antibody targeting LIPF in WB, IHC, ELISA applications with reactivity to human, mouse samples 25889-1-AP targets LIPF in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MKN-45 cells, mouse stomach tissue Positive IHC detected in: human stomach tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information gastric lipase, is an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23149 Product name: Recombinant human LIPF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 299-398 aa of BC112272 Sequence: KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK Predict reactive species Full Name: lipase, gastric Observed Molecular Weight: 49 kDa GenBank Accession Number: BC112272 Gene Symbol: LIPF Gene ID (NCBI): 8513 RRID: AB_2880284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07098 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.