Iright
BRAND / VENDOR: Proteintech

Proteintech, 25899-1-AP, GABRR1 Polyclonal antibody

CATALOG NUMBER: 25899-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GABRR1 (25899-1-AP) by Proteintech is a Polyclonal antibody targeting GABRR1 in WB, ELISA applications with reactivity to human, mouse samples 25899-1-AP targets GABRR1 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GABRR1 is a member of a family of ligand-gated chloride channels that are the major inhibitory neurotransmitter receptors in the central nervous system. GABRR1 acts as a rho-1 receptor of GABA, the major inhibitory neurotransmitter in the vertebrate brain, may play a role in retinal neurotransmission. And then, GABRR1 is highly expressed in the retina and in a lesser extent in brain, lung and thymus. There are 3 isoforms for GABRR1 produced by alternative splicing, with the molecular weights of 46 kDa, 53 kDa, 56 kDa, respectively. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23165 Product name: Recombinant human GABRR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-78 aa of BC130344 Sequence: RMHWPGREVHEMSKKGSRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDD Predict reactive species Full Name: gamma-aminobutyric acid (GABA) receptor, rho 1 Calculated Molecular Weight: 479 aa, 56 kDa Observed Molecular Weight: 50-56 kDa GenBank Accession Number: BC130344 Gene Symbol: GABRR1 Gene ID (NCBI): 2569 RRID: AB_2880290 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24046 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924