Iright
BRAND / VENDOR: Proteintech

Proteintech, 25917-1-AP, GMIP Polyclonal antibody

CATALOG NUMBER: 25917-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GMIP (25917-1-AP) by Proteintech is a Polyclonal antibody targeting GMIP in WB, IHC, IP, ELISA applications with reactivity to human samples 25917-1-AP targets GMIP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GMIP (Gem-interacting protein) is a 970 amino acid protein that stimulates the GTPase activity of RhoA in vitro and in vivo. GMIP interacts with Gem through its N-terminus and has a Rho GTPase-activating protein domain at its C-terminus. The Rho family of GTP-binding proteins plays a role in the development of neuronal structure. GMIP is able to inhibit RhoA function, leading to Actin cytoskeletal reorganization in vivo. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23239 Product name: Recombinant human GMIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC126436 Sequence: MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTK Predict reactive species Full Name: GEM interacting protein Observed Molecular Weight: 130 kDa GenBank Accession Number: BC126436 Gene Symbol: GMIP Gene ID (NCBI): 51291 RRID: AB_2880295 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P107 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924