Proteintech, 25946-1-AP, HARBI1 Polyclonal antibody

Size: 20ul / 150ul The HARBI1 (25946-1-AP) by Proteintech is a Polyclonal antibody targeting HARBI1 in WB, ELISA applications with reactivity to human, mouse samples 25946-1-AP targets HARBI1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, Jurkat cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22522 Product name: Recombinant human HARBI1 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-349 aa of BC036925 Sequence: MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS Predict reactive species Full Name: harbinger transposase derived 1 Calculated Molecular Weight: 349 aa, 39 kDa Observed Molecular Weight: ~39 kDa GenBank Accession Number: BC036925 Gene Symbol: HARBI1 Gene ID (NCBI): 283254 RRID: AB_3669510 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.