Proteintech, 25949-1-AP, CSF1R/CD115 Polyclonal antibody

Size: 20ul / 150ul The CSF1R/CD115 (25949-1-AP) by Proteintech is a Polyclonal antibody targeting CSF1R/CD115 in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 25949-1-AP targets CSF1R/CD115 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissue, human brain tissue, human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Positive IF/ICC detected in: THP-1 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CSF1R (colony-stimulating factor 1 receptor) belongs to the type III protein tyrosine kinase receptor family. CSF1R-mediated signaling is crucial for the differentiation and survival of the mononuclear phagocyte system and macrophages in particular (PMID: 28716061). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22845 Product name: Recombinant human CSF1R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-369 aa of BC047521 Sequence: IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIHQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANVTTKDTYRHTFTLSLP Predict reactive species Full Name: colony stimulating factor 1 receptor Calculated Molecular Weight: 972 aa, 108 kDa GenBank Accession Number: BC047521 Gene Symbol: CSF1R/CD115 Gene ID (NCBI): 1436 RRID: AB_2880306 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07333 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.