Proteintech, 25958-1-AP, SLC19A1 Polyclonal antibody

Size: 20ul / 150ul The SLC19A1 (25958-1-AP) by Proteintech is a Polyclonal antibody targeting SLC19A1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25958-1-AP targets SLC19A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells Positive IHC detected in: human placenta tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC19A1, also named as RFC (reduced folate carrier), is an anionic exchanger that involved in the regulation of intracellular concentrations of folate in exchange for anions. The predicted MW of  SLC19A1 is 65 kDa and 25958-1-AP antibody recognizes the 46 kDa protein which is similar to papers. The 38-40 kDa minor forms and 58 kDa form have also been reported that could be alternate splicing, post-transcriptional modification or the role of accessory proteins. (PMID: 17404734, 9111015) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22921 Product name: Recombinant human SLC19A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 197-266 aa of BC003068 Sequence: VVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELGDSLRRPQ Predict reactive species Full Name: solute carrier family 19 (folate transporter), member 1 Calculated Molecular Weight: 591 aa, 65 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC003068 Gene Symbol: SLC19A1 Gene ID (NCBI): 6573 RRID: AB_2880310 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.