Proteintech, 25975-1-AP, TESPA1 Polyclonal antibody

Size: 20ul / 150ul The TESPA1 (25975-1-AP) by Proteintech is a Polyclonal antibody targeting TESPA1 in WB, ELISA applications with reactivity to human samples 25975-1-AP targets TESPA1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23218 Product name: Recombinant human KIAA0748 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 177-521 aa of BC132732 Sequence: DTSRIPARFFTTPSQAKGIDFQLFLKSQVRRIEMEDPCLMLASRFKQVQTLAVTADAFFCLYSYVSKTPVQKFTPSHMFWNCNHPTDVPSIRILSREPEPQSPRDRLRKAISKMCLYTCPRDRPPPPHNTPKRNSLDQVVLEVMDKVKEEKQFLQQDSDLGQFSQEDPVPPAEGKKLPTSPYPCVFCCEEETQQRMSTVLAPSQTLDSNPKVPCCTHSLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRRSLSQQPQDTFDLEEVQSNSEEEQSQSRWPSRPRHPHHHQTFAGKDS Predict reactive species Full Name: KIAA0748 Calculated Molecular Weight: 521 aa, 59 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC132732 Gene Symbol: TESPA1 Gene ID (NCBI): 9840 RRID: AB_2880315 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A2RU30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.