Proteintech, 25977-1-AP, NRAP Polyclonal antibody

Size: 20ul / 150ul The NRAP (25977-1-AP) by Proteintech is a Polyclonal antibody targeting NRAP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 25977-1-AP targets NRAP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NRAP (Nebulin-related-anchoring protein) is a striated muscle-specific protein that is concentrated at intercalated disks in cardiac muscle and at myotendinous junctions in skeletal muscle. NRAP is a 197 kDa multidomain scaffolding protein from nebulin family with many interation partners such as α-actinin, actin, vinculin and filamin (PMID:21276443). During cardiomyocyte development in the foetal heart, NRAP is involved in myofibrillar assembly and links terminal actin filaments to membrane complexes in the adult heart. Several studies observed that NRAP mutation would contributed to the dilated cardiomyopathy which is a highly heterogeneous disease with almost 100 candidates genes to date (PMID:28611399). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23254 Product name: Recombinant human NRAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1309-1393 aa of BC126407 Sequence: RHDFVKERGKLIGPQSVRDDPRIQHCRRMGQLQSELQYRRGATSSQAQFHLPMDMVHLVHAKNAQALASDHDYRTQYHKFTALPE Predict reactive species Full Name: nebulin-related anchoring protein Observed Molecular Weight: 190-200 kDa GenBank Accession Number: BC126407 Gene Symbol: NRAP Gene ID (NCBI): 4892 RRID: AB_2918098 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86VF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.