Proteintech, 25997-1-AP, XBP-1U specific Polyclonal antibody

Size: 20ul / 150ul The XBP-1U specific (25997-1-AP) by Proteintech is a Polyclonal antibody targeting XBP-1U specific in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 25997-1-AP targets XBP-1U specific in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat spleen tissue, mouse spleen tissue Positive IHC detected in: human breast cancer tissue, human colon cancer tissue, human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information X-box-binding protein 1 (XBP1), also named as TREB5, is a 261 amino acid protein, which contains one bZIP domain and belongs to the bZIP family. XBP1 localizes in the nucleus and as a transcription factor is essential for hepatocyte growth, the differentiation of plasma cells, the immunoglobulin secretion, and the unfolded protein response. XBP1 has an association with major affective disorder. The molecular weight of protein generated from the spliced XBP1 mRNA is 54 kDa and protein generated from unspliced Xbp1 mRNA is 33 kDa. This antibody 25997-1-AP specially recognizes isoform XBP-1U. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21714 Product name: Recombinant human XBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 167-261 aa of BC000938 Sequence: LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN Predict reactive species Full Name: X-box binding protein 1 Calculated Molecular Weight: 261 aa, 29 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC000938 Gene Symbol: XBP1 Gene ID (NCBI): 7494 RRID: AB_2880326 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17861 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.