Iright
BRAND / VENDOR: Proteintech

Proteintech, 26006-1-AP, SLIRP Polyclonal antibody

CATALOG NUMBER: 26006-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLIRP (26006-1-AP) by Proteintech is a Polyclonal antibody targeting SLIRP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26006-1-AP targets SLIRP in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, MDA-MB-453s cells Positive IHC detected in: human ovary cancer tissue, human kidney tissue, human stomach cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SLIRP, also named as C14orf156, DC23, DC50 and PD04872. It is an RNA-binding protein on steroid receptor RNA activator (SRA), and its expression is ubiquitous in human normal tissues. SLIRP can affect mitochondrial mRNA transcription and energy conversion. In addition, the loss or weakening of SLIRP destroys part of the structure of mitochondria, affects mitochondria energy metabolism, and increases sperm or cell oxidative stress damage (PMID: 33150185). SLIRP has 2 isoforms with the molecular mass of 12 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22945 Product name: Recombinant human C14orf156 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC017895 Sequence: MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF Predict reactive species Full Name: chromosome 14 open reading frame 156 Calculated Molecular Weight: 109 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC017895 Gene Symbol: SLIRP Gene ID (NCBI): 81892 RRID: AB_2880332 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZT3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924