Proteintech, 26015-1-AP, RNF128 Polyclonal antibody

Size: 20ul / 150ul The RNF128 (26015-1-AP) by Proteintech is a Polyclonal antibody targeting RNF128 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26015-1-AP targets RNF128 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22834 Product name: Recombinant human RNF128 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 333-428 aa of BC063404 Sequence: DGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS Predict reactive species Full Name: ring finger protein 128 Calculated Molecular Weight: 428 aa, 47 kDa Observed Molecular Weight: 40-47 kDa, 66-70 kDa GenBank Accession Number: BC063404 Gene Symbol: RNF128 Gene ID (NCBI): 79589 RRID: AB_2880336 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TEB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.