Proteintech, 26023-1-AP, ZCCHC13 Polyclonal antibody

Size: 20ul / 150ul The ZCCHC13 (26023-1-AP) by Proteintech is a Polyclonal antibody targeting ZCCHC13 in WB, ELISA applications with reactivity to human, mouse, rat samples 26023-1-AP targets ZCCHC13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZCCHC13 (zinc-finger CCHC-type containing 13) is a member of a family of zinc-finger CCHC-type containing DNA/RNA-binding proteins that are involved in mRNA transcription and protein translation. Downregulation of ZCCHC13 was shown to be associated with spermatogenesis failure in patients with non-obstructive azoospermia (NOA)(PMID: 29531833). It is reported that ZCCHC13 overexpression might be related to global DNA hypomethylation and promote hepatocellular carcinoma (HCC)(PMID: 23891108). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22050 Product name: Recombinant human ZCCHC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC021176 Sequence: MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNI Predict reactive species Full Name: zinc finger, CCHC domain containing 13 Calculated Molecular Weight: 166 aa, 18 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC021176 Gene Symbol: ZCCHC13 Gene ID (NCBI): 389874 RRID: AB_3669517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.