Proteintech, 26027-1-AP, CHST2 Polyclonal antibody

Size: 20ul / 150ul The CHST2 (26027-1-AP) by Proteintech is a Polyclonal antibody targeting CHST2 in WB, ELISA applications with reactivity to human, mouse samples 26027-1-AP targets CHST2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CHST2 encodes N-Acetylglucosamine-6-sulfotransferase-1 (GlcNAc6ST-1), a Golgi-resident glycoprotein that is responsible for sulfation of the L-selectin ligand on endothelial cells. Two isoforms of CHST2 exist due to the alternative splicing. This antibody recognizes both short form and long form, which migrates around 50-52 kDa and 58-60 kDa, respectively. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23293 Product name: Recombinant human CHST2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 338-530 aa of BC105010 Sequence: ASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL Predict reactive species Full Name: carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 Observed Molecular Weight: 50, 58-60 kDa GenBank Accession Number: BC105010 Gene Symbol: CHST2 Gene ID (NCBI): 9435 RRID: AB_2880342 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4C5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.