Proteintech, 26032-1-AP, FAM83B Polyclonal antibody

Size: 20ul / 150ul The FAM83B (26032-1-AP) by Proteintech is a Polyclonal antibody targeting FAM83B in WB, IHC, ELISA applications with reactivity to human samples 26032-1-AP targets FAM83B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human brown diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM83B, also known as C6orf143, belongs to the FAM83 family. FAM83B is an oncogene and promotes cell transformation through activating various pathway in different kinds of tumors. FAM83B over expressed in several kinds of malignant tumors, such as breast cancer, cervical cancer, endometrial cancer, pancreatic ductal adenocarcinoma, etc. Overexpression of FAM83B could promote the malignant biological behaviors of these tumors (PMID: 33423038, 36690987). The calculated molecular weight of FAM83B is 115 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22951 Product name: Recombinant human FAM83B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 653-1011 aa of BC112275 Sequence: NQQTENLLKRRSFPLFDNSKANLDPGNSKHYVYSTLTRNRVRQPEKPKEDLLKSSKSMHNVTHNLEEDEEEVTKRNSPSGTTTKSVSIAALLDVNKEESNKELASKKEVKGSPSFLKKGSQKLRSLLSLTPDKKENLSKNKAPAFYRLCSSSDTLVSEGEENQKPKKSDTKVDSSPRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKFLERAGDASAPRFNTEQIQYRDSREINAVVNPERRPTSSPRPTSSELLRSHSTDRRVYSRFEPFCKIESSIQPTSNMPNTSINRPEIKSATMGNSYGRSSPLLNYNTGVYRSYQPNENKFRGFMQKFGNFIHKNK Predict reactive species Full Name: family with sequence similarity 83, member B Calculated Molecular Weight: 1011 aa, 115 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC112275 Gene Symbol: FAM83B Gene ID (NCBI): 222584 RRID: AB_3085837 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T0W9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.