Proteintech, 26056-1-AP, Ezrin Polyclonal antibody

Size: 20ul / 150ul The Ezrin (26056-1-AP) by Proteintech is a Polyclonal antibody targeting Ezrin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 26056-1-AP targets Ezrin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse stomach tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat eye tissue, mouse eye tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Ezrin is a member of the ERM (Ezrin, Radixin, Moesin) protein family and serves as a crucial linker between the cell membrane and the actin cytoskeleton. It plays significant roles in various cellular processes, including maintaining cell morphology, facilitating cell movement and adhesion, regulating signal transduction, and influencing apoptosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23530 Product name: Recombinant human Ezrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-529 aa of BC013903 Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR Predict reactive species Full Name: ezrin Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC013903 Gene Symbol: Ezrin Gene ID (NCBI): 7430 ENSEMBL Gene ID: ENSG00000092820 RRID: AB_2722561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15311 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.