Proteintech, 26063-1-AP, LRRIQ1 Polyclonal antibody

Size: 20ul / 150ul The LRRIQ1 (26063-1-AP) by Proteintech is a Polyclonal antibody targeting LRRIQ1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26063-1-AP targets LRRIQ1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LRRIQ1 (leucine-rich repeats and IQ motif containing 1), also named as KIAA1801, is known to be hignly expressed in brain and testis tissue. The LRRIQ1 gene is conserved in chimpanzee, Rhesus monkey, dog, cow, mouse, rat, chicken, and zebrafish. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22057 Product name: Recombinant human LRRIQ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-224 aa of BC005399 Sequence: MDDDDAKLKAEIEAELDKLSISSLEKEDIESDAKSETQSDDSDTDSVELPESVLHCINIIKNRSKAVEELILQDLEDILSCSYGAVSNNHMHLRTGLSTEYEESSEQLIKILSEIEKEEFMRSKTDCATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKRHCWMKQFKVEKKKLENIQK Predict reactive species Full Name: leucine-rich repeats and IQ motif containing 1 Calculated Molecular Weight: 1722 aa, 199 kDa Observed Molecular Weight: 190-200 kDa GenBank Accession Number: BC005399 Gene Symbol: LRRIQ1 Gene ID (NCBI): 84125 RRID: AB_3085838 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.