Proteintech, 26077-1-AP, CLEC12B Polyclonal antibody

Size: 20ul / 150ul The CLEC12B (26077-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC12B in WB, ELISA applications with reactivity to human, mouse, rat samples 26077-1-AP targets CLEC12B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, K-562 cells, mouse spleen tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CLEC12B (C-type lectin domain family 12 member B) is a single-pass type II membrane protein of the C-type lectin-like family. CLEC12B acts as an inhibitory receptor on myeloid cells. CLEC12B may be involved in limiting the activity of monocyte-derived immune cells after cell differentiation and possibly during inflammatory diseases. (PMID: 17562706) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23396 Product name: Recombinant human CLEC12B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 65-232 aa of BC136805 Sequence: LQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQEQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLYVSNY Predict reactive species Full Name: C-type lectin domain family 12, member B Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC136805 Gene Symbol: CLEC12B Gene ID (NCBI): 387837 RRID: AB_2880365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2HXU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.