Proteintech, 26082-1-AP, ENT2 Polyclonal antibody

Size: 20ul / 150ul The ENT2 (26082-1-AP) by Proteintech is a Polyclonal antibody targeting ENT2 in WB, ELISA applications with reactivity to human, mouse, rat samples 26082-1-AP targets ENT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC29A2 also known as ENT2, comprises 456 amino acids and shares 46% amino acid identity with ENT1. ENT2 is involved in the facilitative transport of nucleosides and nucleobases and maintains their cellular homeostasis. The predicted molecular weight of ENT2 is 50 kDa, while 45 kDa band may be observed due to the deglycosylation (PMID: 10722669) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23310 Product name: Recombinant human SLC29A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-321 aa of BC093634 Sequence: PHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSP Predict reactive species Full Name: solute carrier family 29 (nucleoside transporters), member 2 Observed Molecular Weight: 50 kDa GenBank Accession Number: BC093634 Gene Symbol: SLC29A2 Gene ID (NCBI): 3177 RRID: AB_3669522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14542 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.